PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G091100.1
Common NamePHAVU_003G091100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 272aa    MW: 30262.2 Da    PI: 8.1327
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G091100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.41.3e-3167124260
         ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                         + vrY+eClkNhAa++Gg+a+DGCgEfmps geegt++al+C+AC CHRnFHR+eve e
  Phvul.003G091100.1  67 KMVRYRECLKNHAAAMGGNATDGCGEFMPS-GEEGTIEALNCSACHCHRNFHRKEVEGE 124
                         679**************************9.999*********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-2569132IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.1E-2869121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.6E-3070121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.3371120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.608.8E-31191264IPR009057Homeodomain-like
SuperFamilySSF466891.79E-19195263IPR009057Homeodomain-like
TIGRFAMsTIGR015651.7E-27202258IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MELSSQEGEI PIPINSATYG GGHGNGHGHG LMIHHDPPHH NHDHIISSTA PSNGTPTMQQ  60
EDHGYKKMVR YRECLKNHAA AMGGNATDGC GEFMPSGEEG TIEALNCSAC HCHRNFHRKE  120
VEGEAASCDY HPFNRRRLIL GPHKNLLPPE ALGYPTGNIL PSRSVPPHQM IMPYSIGHLP  180
SESDEQEDGG GMVQPRPSQL VKKRFRTKFT QEQKEKMLNF AERVGWKIQK QEESVVQQFC  240
QEIGVKRRVL KVWMHNNKHN LAKKNPPTAA A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-242032601875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007154109.10.0hypothetical protein PHAVU_003G091100g
SwissprotQ9M9S06e-79ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLV7C9S30.0V7C9S3_PHAVU; Uncharacterized protein
STRINGGLYMA07G40190.11e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-78homeobox protein 31